SCOPe 2.07: Domain d1xvib_: 1xvi B:

Lineage for d1xvib_ (1xvi B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) [117505] (2 species)

7. Species Escherichia coli [TaxId:562] [117506] (1 PDB entry)
   Uniprot P76329 4-235

8. Domain d1xvib_: 1xvi B: [116089]
   Structural genomics target
   complexed with 1pe, pg4, pge, so4

Details for d1xvib_

PDB Entry: 1xvi, 2.26 Å

PDB Description: Crystal Structure of YedP, phosphatase-like domain protein from Escherichia coli K12

PDB Compounds: (B:) Putative mannosyl-3-phosphoglycerate phosphatase

SCOPe Domain Sequences for d1xvib_:

Sequence; same for both SEQRES and ATOM records:

>d1xvib_ c.108.1.10 (B:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]}
mfsiqqpllvfsdldgtlldshsydwqpaapwltrlreanvpvilcssktsaemlylqkt
lglqglpliaengaviqlaeqwqeidgfpriisgishgeislvlntlrekehfkfttfdd
vddatiaewtglsrsqaaltqlheasvtliwrdsdermaqftarlnelglqfmqgarfwh
vldasagkdqaanwiiatyqqlsgkrpttlglgdgpndapllevmdyavivkgl

Timeline for d1xvib_:

• d1xvib_ first appeared in SCOP 1.71
  
• d1xvib_ appears in SCOPe 2.06
  
• d1xvib_ appears in the current release, SCOPe 2.08