![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
![]() | Protein Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) [117505] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [117506] (1 PDB entry) Uniprot P76329 4-235 |
![]() | Domain d1xvia_: 1xvi A: [116088] Structural genomics target complexed with 1pe, pg4, pge, so4 |
PDB Entry: 1xvi (more details), 2.26 Å
SCOPe Domain Sequences for d1xvia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} iqqpllvfsdldgtlldshsydwqpaapwltrlreanvpvilcssktsaemlylqktlgl qglpliaengaviqlaeqwqeidgfpriisgishgeislvlntlrekehfkfttfddvdd atiaewtglsrsqaaltqlheasvtliwrdsdermaqftarlnelglqfmqgarfwhvld asagkdqaanwiiatyqqlsgkrpttlglgdgpndapllevmdyavivkgln
Timeline for d1xvia_: