Lineage for d1xv9c_ (1xv9 C:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543673Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 543674Species Human (Homo sapiens) [TaxId:9606] [48511] (14 PDB entries)
  8. 543699Domain d1xv9c_: 1xv9 C: [116082]
    Other proteins in same PDB: d1xv9b_, d1xv9d_
    complexed with ci2, f15

Details for d1xv9c_

PDB Entry: 1xv9 (more details), 2.7 Å

PDB Description: crystal structure of car/rxr heterodimer bound with src1 peptide, fatty acid, and 5b-pregnane-3,20-dione.

SCOP Domain Sequences for d1xv9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xv9c_ a.123.1.1 (C:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens)}
nedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakri
phfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaif
drvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckh
kypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

SCOP Domain Coordinates for d1xv9c_:

Click to download the PDB-style file with coordinates for d1xv9c_.
(The format of our PDB-style files is described here.)

Timeline for d1xv9c_: