Lineage for d1xv2d_ (1xv2 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009890Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
    duplication: consists of two similar beta-alpha-beta(4) motifs
  4. 3009891Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) (S)
    characteristic metal ion (zinc)-binding motif in the putative active site
  5. 3009892Family d.290.1.1: Alpha-acetolactate decarboxylase-like [117857] (1 protein)
    Pfam PF03306
  6. 3009893Protein Hypothetical protein SA2394 [117858] (1 species)
  7. 3009894Species Staphylococcus aureus [TaxId:1280] [117859] (1 PDB entry)
    Uniprot Q7A3A7
  8. 3009898Domain d1xv2d_: 1xv2 D: [116079]
    Structural genomics target
    complexed with zn

Details for d1xv2d_

PDB Entry: 1xv2 (more details), 2 Å

PDB Description: Crystal Structure of a Protein of Unknown Function Similar to Alpha-acetolactate Decarboxylase from Staphylococcus aureus
PDB Compounds: (D:) hypothetical protein, similar to alpha-acetolactate decarboxylase

SCOPe Domain Sequences for d1xv2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xv2d_ d.290.1.1 (D:) Hypothetical protein SA2394 {Staphylococcus aureus [TaxId: 1280]}
nvlyqhgtlgtlmagllegtatinellehgnlgiatltgsdgevifldgkayhanehkef
ielkgdekvpyasitnfkasktfplqqlsqddvfaqiknemlsenlfsavkiygtfkhmh
vrmmpaqqppytrlidsarrqpeekrqdirgaivgfftpelfhgvgsagfhihfaddera
ygghvldfevddvvveiqnfetfqqhfpvnnetfvkakidykdvaeeireae

SCOPe Domain Coordinates for d1xv2d_:

Click to download the PDB-style file with coordinates for d1xv2d_.
(The format of our PDB-style files is described here.)

Timeline for d1xv2d_: