![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.6: NeuB-like [110368] (3 proteins) Pfam PF03102 |
![]() | Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (2 species) |
![]() | Species Neisseria meningitidis [TaxId:487] [117381] (4 PDB entries) Uniprot Q57265 |
![]() | Domain d1xuza2: 1xuz A:2-281 [116073] Other proteins in same PDB: d1xuza1 complexed with mmn, mn, pep |
PDB Entry: 1xuz (more details), 2.2 Å
SCOPe Domain Sequences for d1xuza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuza2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag
Timeline for d1xuza2: