Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (6 families) Common fold covers whole protein structure |
Family c.1.10.6: NeuB-like [110368] (2 proteins) Pfam 03102 |
Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (1 species) |
Species Neisseria meningitidis [TaxId:487] [117381] (2 PDB entries) |
Domain d1xuza2: 1xuz A:2-281 [116073] Other proteins in same PDB: d1xuza1 complexed with mmn, mn, pep |
PDB Entry: 1xuz (more details), 2.2 Å
SCOP Domain Sequences for d1xuza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuza2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis} qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag
Timeline for d1xuza2: