SCOPe 2.08: Domain d1xuva1: 1xuv A:11-170

Lineage for d1xuva1 (1xuv A:11-170)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
   Pfam PF05146

6. Protein Hypothetical protein MM0500 [118095] (1 species)

7. Species Methanosarcina mazei [TaxId:2209] [118096] (1 PDB entry)
   Uniprot Q8PZJ2

8. Domain d1xuva1: 1xuv A:11-170 [116069]
   Other proteins in same PDB: d1xuva2, d1xuvb2, d1xuvc2
   Structural genomics target

Details for d1xuva1

PDB Entry: 1xuv, 2.1 Å

PDB Description: x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10.

PDB Compounds: (A:) hypothetical protein MM0500

SCOPe Domain Sequences for d1xuva1:

Sequence; same for both SEQRES and ATOM records:

>d1xuva1 d.129.3.5 (A:11-170) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]}
nptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttalkifepknggs
wqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarfealpgdrtkl
tshsvfqtiedrdgmlqsgmeegindsyerldellekmkk

Timeline for d1xuva1:

• d1xuva1 first appeared in SCOP 1.71, called d1xuva_
  
• d1xuva1 appears in SCOPe 2.07