Lineage for d1xuva1 (1xuv A:11-170)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975805Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
    Pfam PF05146
  6. 2975832Protein Hypothetical protein MM0500 [118095] (1 species)
  7. 2975833Species Methanosarcina mazei [TaxId:2209] [118096] (1 PDB entry)
    Uniprot Q8PZJ2
  8. 2975834Domain d1xuva1: 1xuv A:11-170 [116069]
    Other proteins in same PDB: d1xuva2, d1xuvb2, d1xuvc2
    Structural genomics target

Details for d1xuva1

PDB Entry: 1xuv (more details), 2.1 Å

PDB Description: x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10.
PDB Compounds: (A:) hypothetical protein MM0500

SCOPe Domain Sequences for d1xuva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuva1 d.129.3.5 (A:11-170) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]}
nptritaepgkqeiiitrefdaprelvfkaftdpdlytqwigprgfttalkifepknggs
wqyiqkdpegneyafhgvnhdvteperiistfefeglpekghvildtarfealpgdrtkl
tshsvfqtiedrdgmlqsgmeegindsyerldellekmkk

SCOPe Domain Coordinates for d1xuva1:

Click to download the PDB-style file with coordinates for d1xuva1.
(The format of our PDB-style files is described here.)

Timeline for d1xuva1: