SCOP 1.73: Domain d1xuua2: 1xuu A:2-281

Lineage for d1xuua2 (1xuu A:2-281)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.6: NeuB-like [110368] (2 proteins)
   Pfam PF03102

6. Protein Capsule biosynthesis protein SiaC, N-terminal domain [117380] (1 species)

7. Species Neisseria meningitidis [TaxId:487] [117381] (2 PDB entries)

8. Domain d1xuua2: 1xuu A:2-281 [116068]
   Other proteins in same PDB: d1xuua1
   complexed with mlt, mn

Details for d1xuua2

PDB Entry: 1xuu, 1.9 Å

PDB Description: Crystal structure of sialic acid synthase (NeuB) in complex with Mn2+ and Malate from Neisseria meningitidis

PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOP Domain Sequences for d1xuua2:

Sequence; same for both SEQRES and ATOM records:

>d1xuua2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]}
qnnnefkignrsvgynhepliiceiginhegslktafemvdaaynagaevvkhqthived
emsdeakqvipgnadvsiyeimercalneedeiklkeyveskgmifistpfsraaalrlq
rmdipaykigsgecnnypliklvasfgkpiilstgmnsiesikksveiireagvpyallh
ctniyptpyedvrlggmndlseafpdaiiglsdhtldnyaclgavalggsilerhftdrm
drpgpdivcsmnpdtfkelkqgahalklarggkkdtiiag

Timeline for d1xuua2:

• d1xuua2 first appeared in SCOP 1.71
  
• d1xuua2 appears in SCOP 1.75
  
• d1xuua2 appears in the current release, SCOPe 2.08