SCOPe 2.01: Domain d1xuua1: 1xuu A:282-349

Lineage for d1xuua1 (1xuu A:282-349)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.1: AFP III-like domain [51269] (1 family)
   duplication: consists of two structural repeats related by pseudo dyad

5. Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
   Pfam PF01354

6. Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (1 species)

7. Species Neisseria meningitidis [TaxId:487] [117331] (4 PDB entries)
   Uniprot Q57265

8. Domain d1xuua1: 1xuu A:282-349 [116067]
   Other proteins in same PDB: d1xuua2
   complexed with mlt, mn

Details for d1xuua1

PDB Entry: 1xuu, 1.9 Å

PDB Description: Crystal structure of sialic acid synthase (NeuB) in complex with Mn2+ and Malate from Neisseria meningitidis

PDB Compounds: (A:) polysialic acid capsule biosynthesis protein SiaC

SCOPe Domain Sequences for d1xuua1:

Sequence; same for both SEQRES and ATOM records:

>d1xuua1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis [TaxId: 487]}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie

Timeline for d1xuua1:

• d1xuua1 first appeared in SCOP 1.71
  
• d1xuua1 appears in SCOP 1.75
  
• d1xuua1 appears in SCOPe 2.02
  
• d1xuua1 appears in the current release, SCOPe 2.08