![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.1: AFP III-like domain [51269] (1 family) ![]() duplication: consists of two structural repeats related by pseudo dyad |
![]() | Family b.85.1.1: AFP III-like domain [51270] (3 proteins) Pfam 01354 |
![]() | Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:487] [117331] (2 PDB entries) |
![]() | Domain d1xuua1: 1xuu A:282-349 [116067] Other proteins in same PDB: d1xuua2 complexed with mlt, mn |
PDB Entry: 1xuu (more details), 1.9 Å
SCOP Domain Sequences for d1xuua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuua1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis} ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga qikktdie
Timeline for d1xuua1: