Lineage for d1xuua1 (1xuu A:282-349)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568126Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 568127Superfamily b.85.1: AFP III-like domain [51269] (1 family) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 568128Family b.85.1.1: AFP III-like domain [51270] (3 proteins)
    Pfam 01354
  6. 568129Protein Capsule biosynthesis protein SiaC, C-terminal domain [117330] (1 species)
  7. 568130Species Neisseria meningitidis [TaxId:487] [117331] (2 PDB entries)
  8. 568131Domain d1xuua1: 1xuu A:282-349 [116067]
    Other proteins in same PDB: d1xuua2
    complexed with mlt, mn

Details for d1xuua1

PDB Entry: 1xuu (more details), 1.9 Å

PDB Description: Crystal structure of sialic acid synthase (NeuB) in complex with Mn2+ and Malate from Neisseria meningitidis

SCOP Domain Sequences for d1xuua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuua1 b.85.1.1 (A:282-349) Capsule biosynthesis protein SiaC, C-terminal domain {Neisseria meningitidis}
ekptkdfafasvvadkdikkgellsgdnlwvkrpgngdfsvneyetlfgkvaacnirkga
qikktdie

SCOP Domain Coordinates for d1xuua1:

Click to download the PDB-style file with coordinates for d1xuua1.
(The format of our PDB-style files is described here.)

Timeline for d1xuua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xuua2