Lineage for d1xuta1 (1xut A:68-109)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639499Family g.24.1.2: BAFF receptor-like [90174] (4 proteins)
    only fragments of the receptor structures are available; no domain division is provided here
  6. 2639500Protein Tumor necrosis factor receptor superfamily member 13B, TACI [118262] (1 species)
  7. 2639501Species Human (Homo sapiens) [TaxId:9606] [118263] (2 PDB entries)
    Uniprot O14836 68-109
  8. 2639505Domain d1xuta1: 1xut A:68-109 [116066]
    Other proteins in same PDB: d1xuta2

Details for d1xuta1

PDB Entry: 1xut (more details)

PDB Description: solution structure of taci-crd2
PDB Compounds: (A:) Tumor necrosis factor receptor superfamily member 13B

SCOPe Domain Sequences for d1xuta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuta1 g.24.1.2 (A:68-109) Tumor necrosis factor receptor superfamily member 13B, TACI {Human (Homo sapiens) [TaxId: 9606]}
slscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr

SCOPe Domain Coordinates for d1xuta1:

Click to download the PDB-style file with coordinates for d1xuta1.
(The format of our PDB-style files is described here.)

Timeline for d1xuta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xuta2