SCOPe 2.03: Domain d1xuta_: 1xut A:

Lineage for d1xuta_ (1xut A:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.2: BAFF receptor-like [90174] (4 proteins)
   only fragments of the receptor structures are available; no domain division is provided here

6. Protein Tumor necrosis factor receptor superfamily member 13B, TACI [118262] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118263] (2 PDB entries)
   Uniprot O14836 68-109

8. Domain d1xuta_: 1xut A: [116066]

Details for d1xuta_

PDB Entry: 1xut

PDB Description: solution structure of taci-crd2

PDB Compounds: (A:) Tumor necrosis factor receptor superfamily member 13B

SCOPe Domain Sequences for d1xuta_:

Sequence; same for both SEQRES and ATOM records:

>d1xuta_ g.24.1.2 (A:) Tumor necrosis factor receptor superfamily member 13B, TACI {Human (Homo sapiens) [TaxId: 9606]}
gspwslscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr

Timeline for d1xuta_:

• d1xuta_ first appeared in SCOP 1.71
  
• d1xuta_ appears in SCOPe 2.02
  
• d1xuta_ appears in SCOPe 2.04
  
• d1xuta_ appears in the current release, SCOPe 2.08, called d1xuta1