![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
![]() | Superfamily g.24.1: TNF receptor-like [57586] (3 families) ![]() |
![]() | Family g.24.1.2: BAFF receptor-like [90174] (4 proteins) only fragments of the receptor structures are available; no domain division is provided here |
![]() | Protein Tumor necrosis factor receptor superfamily member 13B, TACI [118262] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118263] (2 PDB entries) Uniprot O14836 68-109 |
![]() | Domain d1xuta_: 1xut A: [116066] |
PDB Entry: 1xut (more details)
SCOPe Domain Sequences for d1xuta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuta_ g.24.1.2 (A:) Tumor necrosis factor receptor superfamily member 13B, TACI {Human (Homo sapiens) [TaxId: 9606]} gspwslscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr
Timeline for d1xuta_: