Lineage for d1xuta_ (1xut A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064701Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 1064702Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 1064801Family g.24.1.2: BAFF receptor-like [90174] (4 proteins)
    only fragments of the receptor structures are available; no domain division is provided here
  6. 1064802Protein Tumor necrosis factor receptor superfamily member 13B, TACI [118262] (1 species)
  7. 1064803Species Human (Homo sapiens) [TaxId:9606] [118263] (2 PDB entries)
    Uniprot O14836 68-109
  8. 1064807Domain d1xuta_: 1xut A: [116066]

Details for d1xuta_

PDB Entry: 1xut (more details)

PDB Description: solution structure of taci-crd2
PDB Compounds: (A:) Tumor necrosis factor receptor superfamily member 13B

SCOPe Domain Sequences for d1xuta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuta_ g.24.1.2 (A:) Tumor necrosis factor receptor superfamily member 13B, TACI {Human (Homo sapiens) [TaxId: 9606]}
gspwslscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr

SCOPe Domain Coordinates for d1xuta_:

Click to download the PDB-style file with coordinates for d1xuta_.
(The format of our PDB-style files is described here.)

Timeline for d1xuta_: