Lineage for d1xuta_ (1xut A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623818Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 623819Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 623886Family g.24.1.2: BAFF receptor-like [90174] (3 proteins)
    only fragments of the receptor structures are available; no domain division is provided here
  6. 623887Protein Tumor necrosis factor receptor superfamily member 13B, TACI [118262] (1 species)
  7. 623888Species Human (Homo sapiens) [TaxId:9606] [118263] (2 PDB entries)
  8. 623892Domain d1xuta_: 1xut A: [116066]

Details for d1xuta_

PDB Entry: 1xut (more details)

PDB Description: solution structure of taci-crd2

SCOP Domain Sequences for d1xuta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuta_ g.24.1.2 (A:) Tumor necrosis factor receptor superfamily member 13B, TACI {Human (Homo sapiens)}
gspwslscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr

SCOP Domain Coordinates for d1xuta_:

Click to download the PDB-style file with coordinates for d1xuta_.
(The format of our PDB-style files is described here.)

Timeline for d1xuta_: