SCOPe 2.08: Domain d1xuta1: 1xut A:68-109

Lineage for d1xuta1 (1xut A:68-109)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.24: TNF receptor-like [57585] (1 superfamily)
   duplication: consists of three similar disulfide-rich domains

4. Superfamily g.24.1: TNF receptor-like [57586] (3 families)

5. Family g.24.1.2: BAFF receptor-like [90174] (4 proteins)
   only fragments of the receptor structures are available; no domain division is provided here

6. Protein Tumor necrosis factor receptor superfamily member 13B, TACI [118262] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118263] (2 PDB entries)
   Uniprot O14836 68-109

8. Domain d1xuta1: 1xut A:68-109 [116066]
   Other proteins in same PDB: d1xuta2

Details for d1xuta1

PDB Entry: 1xut

PDB Description: solution structure of taci-crd2

PDB Compounds: (A:) Tumor necrosis factor receptor superfamily member 13B

SCOPe Domain Sequences for d1xuta1:

Sequence; same for both SEQRES and ATOM records:

>d1xuta1 g.24.1.2 (A:68-109) Tumor necrosis factor receptor superfamily member 13B, TACI {Human (Homo sapiens) [TaxId: 9606]}
slscrkeqgkfydhllrdciscasicgqhpkqcayfcenklr

Timeline for d1xuta1:

• d1xuta1 first appeared in SCOP 1.71, called d1xuta_
  
• d1xuta1 appears in SCOPe 2.07