Lineage for d1xupx1 (1xup X:6-256)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858084Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 1858085Protein Glycerol kinase [53090] (2 species)
  7. 1858086Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
    Uniprot O34153 5-491
  8. 1858125Domain d1xupx1: 1xup X:6-256 [116064]
    complexed with gol

Details for d1xupx1

PDB Entry: 1xup (more details), 2.75 Å

PDB Description: enterococcus casseliflavus glycerol kinase complexed with glycerol
PDB Compounds: (X:) glycerol kinase

SCOPe Domain Sequences for d1xupx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xupx1 c.55.1.4 (X:6-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
yvmaidqgttssraiifdrngkkigssqkefpqyfpksgwvehnaneiwnsvqsviagaf
iesgirpeaiagigitnqrettvvwdkttgqpianaivwqsrqsspiadqlkvdghtemi
hektglvidayfsatkvrwlldniegaqekadngellfgtidswlvwkltdgqvhvtdys
nasrtmlynihklewdqeildllnipssmlpevksnsevyghtrsyhfygsevpiagmag
dqqaalfgqma

SCOPe Domain Coordinates for d1xupx1:

Click to download the PDB-style file with coordinates for d1xupx1.
(The format of our PDB-style files is described here.)

Timeline for d1xupx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xupx2