SCOP 1.75: Domain d1xuab2: 1xua B:129-278

Lineage for d1xuab2 (1xua B:129-278)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (4 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam PF02567

6. Protein Phenazine biosynthesis protein PhzF [117861] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [117862] (6 PDB entries)
   Uniprot Q51792

8. Domain d1xuab2: 1xua B:129-278 [116059]
   complexed with hha

Details for d1xuab2

PDB Entry: 1xua, 1.9 Å

PDB Description: structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens

PDB Compounds: (B:) Phenazine biosynthesis protein phzF

SCOP Domain Sequences for d1xuab2:

Sequence; same for both SEQRES and ATOM records:

>d1xuab2 d.21.1.2 (B:129-278) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
rdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfhdmaincfa
gagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgveigrpslm
fakaegraeqltrvevsgngvtfgrgtivl

Timeline for d1xuab2:

• d1xuab2 first appeared in SCOP 1.71
  
• d1xuab2 appears in SCOP 1.73
  
• d1xuab2 appears in SCOPe 2.01
  
• d1xuab2 appears in the current release, SCOPe 2.08