| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
| Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins) Pfam 02567 |
| Protein Phenazine biosynthesis protein PhzF [117861] (1 species) |
| Species Pseudomonas fluorescens [TaxId:294] [117862] (6 PDB entries) |
| Domain d1xuab1: 1xua B:1-128 [116058] |
PDB Entry: 1xua (more details), 1.9 Å
SCOP Domain Sequences for d1xuab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuab1 d.21.1.2 (B:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens}
mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
iptwtalg
Timeline for d1xuab1: