SCOP 1.71: Domain d1xuab1: 1xua B:1-128

Lineage for d1xuab1 (1xua B:1-128)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
   Pfam 02567

6. Protein Phenazine biosynthesis protein PhzF [117861] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [117862] (6 PDB entries)

8. Domain d1xuab1: 1xua B:1-128 [116058]

Details for d1xuab1

PDB Entry: 1xua, 1.9 Å

PDB Description: structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens

SCOP Domain Sequences for d1xuab1:

Sequence; same for both SEQRES and ATOM records:

>d1xuab1 d.21.1.2 (B:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens}
mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
iptwtalg

Timeline for d1xuab1:

• d1xuab1 is new in SCOP 1.71
  
• d1xuab1 appears in SCOP 1.73
  
• d1xuab1 appears in the current release, SCOPe 2.08