![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (3 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins) Pfam 02567 |
![]() | Protein Phenazine biosynthesis protein PhzF [117861] (1 species) |
![]() | Species Pseudomonas fluorescens [TaxId:294] [117862] (6 PDB entries) |
![]() | Domain d1xuaa2: 1xua A:129-278 [116057] |
PDB Entry: 1xua (more details), 1.9 Å
SCOP Domain Sequences for d1xuaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xuaa2 d.21.1.2 (A:129-278) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens} rdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfhdmaincfa gagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgveigrpslm fakaegraeqltrvevsgngvtfgrgtivl
Timeline for d1xuaa2: