Lineage for d1xuaa1 (1xua A:1-128)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1199029Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 1199030Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 1199046Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins)
    Pfam PF02567
  6. 1199073Protein Phenazine biosynthesis protein PhzF [117861] (1 species)
  7. 1199074Species Pseudomonas fluorescens [TaxId:294] [117862] (6 PDB entries)
    Uniprot Q51792
  8. 1199083Domain d1xuaa1: 1xua A:1-128 [116056]
    complexed with hha

Details for d1xuaa1

PDB Entry: 1xua (more details), 1.9 Å

PDB Description: structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens
PDB Compounds: (A:) Phenazine biosynthesis protein phzF

SCOPe Domain Sequences for d1xuaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xuaa1 d.21.1.2 (A:1-128) Phenazine biosynthesis protein PhzF {Pseudomonas fluorescens [TaxId: 294]}
mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
iptwtalg

SCOPe Domain Coordinates for d1xuaa1:

Click to download the PDB-style file with coordinates for d1xuaa1.
(The format of our PDB-style files is described here.)

Timeline for d1xuaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xuaa2