Lineage for d1xu7a_ (1xu7 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 819766Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 819770Species Human (Homo sapiens) [TaxId:9606] [117424] (11 PDB entries)
    Uniprot P28845
  8. 819775Domain d1xu7a_: 1xu7 A: [116048]

Details for d1xu7a_

PDB Entry: 1xu7 (more details), 1.8 Å

PDB Description: Crystal Structure of the Interface Open Conformation of Tetrameric 11b-HSD1
PDB Compounds: (A:) Corticosteroid 11-beta-dehydrogenase, isozyme 1

SCOP Domain Sequences for d1xu7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu7a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
ysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyyds
slwttllirnpsrkileflysts

SCOP Domain Coordinates for d1xu7a_:

Click to download the PDB-style file with coordinates for d1xu7a_.
(The format of our PDB-style files is described here.)

Timeline for d1xu7a_: