SCOPe 2.05: Domain d1xu4a2: 1xu4 A:65-322

Lineage for d1xu4a2 (1xu4 A:65-322)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)

7. Species Methanococcus voltae [TaxId:2188] [110555] (11 PDB entries)
   Uniprot O73948

8. Domain d1xu4a2: 1xu4 A:65-322 [116046]
   Other proteins in same PDB: d1xu4a1
   complexed with anp, k, mg

Details for d1xu4a2

PDB Entry: 1xu4, 2.4 Å

PDB Description: atpase in complex with amp-pnp, magnesium and potassium co-f

PDB Compounds: (A:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d1xu4a2:

Sequence; same for both SEQRES and ATOM records:

>d1xu4a2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl
adlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvaklydsp
hlpdaeaifritekgiqd

Timeline for d1xu4a2:

• d1xu4a2 first appeared in SCOP 1.71
  
• d1xu4a2 appears in SCOPe 2.04
  
• d1xu4a2 appears in SCOPe 2.06
  
• d1xu4a2 appears in the current release, SCOPe 2.08