Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein DNA repair protein Rad51, catalytic domain [82412] (7 species) |
Species Methanococcus voltae [TaxId:2188] [110555] (14 PDB entries) Uniprot O73948 |
Domain d1xu4a2: 1xu4 A:65-322 [116046] Other proteins in same PDB: d1xu4a1 complexed with anp, k, mg |
PDB Entry: 1xu4 (more details), 2.4 Å
SCOPe Domain Sequences for d1xu4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xu4a2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]} ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn sdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmatlnkl adlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvaklydsp hlpdaeaifritekgiqd
Timeline for d1xu4a2: