Lineage for d1xu2a_ (1xu2 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386843Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2386844Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2386845Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2386857Protein A proliferation-inducing ligand, APRIL [117117] (1 species)
  7. 2386858Species Mouse (Mus musculus) [TaxId:10090] [117118] (5 PDB entries)
    Uniprot Q9D777 105-251 ! Uniprot Q9D777 105-241
  8. 2386863Domain d1xu2a_: 1xu2 A: [116039]
    Other proteins in same PDB: d1xu2r_, d1xu2s_, d1xu2t_
    complexed with ni

Details for d1xu2a_

PDB Entry: 1xu2 (more details), 2.35 Å

PDB Description: The crystal structure of APRIL bound to BCMA
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 13

SCOPe Domain Sequences for d1xu2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu2a_ b.22.1.1 (A:) A proliferation-inducing ligand, APRIL {Mouse (Mus musculus) [TaxId: 10090]}
khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
aklslsphgtflgfvkl

SCOPe Domain Coordinates for d1xu2a_:

Click to download the PDB-style file with coordinates for d1xu2a_.
(The format of our PDB-style files is described here.)

Timeline for d1xu2a_: