Lineage for d1xu1s_ (1xu1 S:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964311Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 1964312Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 1964415Family g.24.1.2: BAFF receptor-like [90174] (4 proteins)
    only fragments of the receptor structures are available; no domain division is provided here
  6. 1964416Protein Tumor necrosis factor receptor superfamily member 13B, TACI [118262] (1 species)
  7. 1964417Species Human (Homo sapiens) [TaxId:9606] [118263] (2 PDB entries)
    Uniprot O14836 68-109
  8. 1964419Domain d1xu1s_: 1xu1 S: [116037]
    Other proteins in same PDB: d1xu1a_, d1xu1b_, d1xu1d_
    complexed with ni

Details for d1xu1s_

PDB Entry: 1xu1 (more details), 1.9 Å

PDB Description: The crystal structure of APRIL bound to TACI
PDB Compounds: (S:) Tumor necrosis factor receptor superfamily member 13B

SCOPe Domain Sequences for d1xu1s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu1s_ g.24.1.2 (S:) Tumor necrosis factor receptor superfamily member 13B, TACI {Human (Homo sapiens) [TaxId: 9606]}
crkeqgkfydhllrdciscasicgqhpkqcayfcen

SCOPe Domain Coordinates for d1xu1s_:

Click to download the PDB-style file with coordinates for d1xu1s_.
(The format of our PDB-style files is described here.)

Timeline for d1xu1s_: