Class g: Small proteins [56992] (90 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (2 families) |
Family g.24.1.2: BAFF receptor-like [90174] (3 proteins) only fragments of the receptor structures are available; no domain division is provided here |
Protein Tumor necrosis factor receptor superfamily member 13B, TACI [118262] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [118263] (2 PDB entries) Uniprot O14836 68-109 |
Domain d1xu1s_: 1xu1 S: [116037] Other proteins in same PDB: d1xu1a_, d1xu1b_, d1xu1d_ |
PDB Entry: 1xu1 (more details), 1.9 Å
SCOP Domain Sequences for d1xu1s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xu1s_ g.24.1.2 (S:) Tumor necrosis factor receptor superfamily member 13B, TACI {Human (Homo sapiens) [TaxId: 9606]} crkeqgkfydhllrdciscasicgqhpkqcayfcen
Timeline for d1xu1s_: