![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (1 family) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (12 proteins) |
![]() | Protein A proliferation-inducing ligand, APRIL [117117] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117118] (5 PDB entries) |
![]() | Domain d1xu1d_: 1xu1 D: [116035] Other proteins in same PDB: d1xu1r_, d1xu1s_, d1xu1t_ complexed with ni |
PDB Entry: 1xu1 (more details), 1.9 Å
SCOP Domain Sequences for d1xu1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xu1d_ b.22.1.1 (D:) A proliferation-inducing ligand, APRIL {Mouse (Mus musculus)} khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran aklslsphgtflgfvkl
Timeline for d1xu1d_: