Lineage for d1xu1d_ (1xu1 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777185Protein A proliferation-inducing ligand, APRIL [117117] (1 species)
  7. 2777186Species Mouse (Mus musculus) [TaxId:10090] [117118] (5 PDB entries)
    Uniprot Q9D777 105-251 ! Uniprot Q9D777 105-241
  8. 2777189Domain d1xu1d_: 1xu1 D: [116035]
    Other proteins in same PDB: d1xu1r_, d1xu1s_, d1xu1t_
    complexed with ni

Details for d1xu1d_

PDB Entry: 1xu1 (more details), 1.9 Å

PDB Description: The crystal structure of APRIL bound to TACI
PDB Compounds: (D:) Tumor necrosis factor ligand superfamily member 13

SCOPe Domain Sequences for d1xu1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu1d_ b.22.1.1 (D:) A proliferation-inducing ligand, APRIL {Mouse (Mus musculus) [TaxId: 10090]}
khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
aklslsphgtflgfvkl

SCOPe Domain Coordinates for d1xu1d_:

Click to download the PDB-style file with coordinates for d1xu1d_.
(The format of our PDB-style files is described here.)

Timeline for d1xu1d_: