Lineage for d1xu1b_ (1xu1 B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793598Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 793599Superfamily b.22.1: TNF-like [49842] (1 family) (S)
  5. 793600Family b.22.1.1: TNF-like [49843] (14 proteins)
  6. 793612Protein A proliferation-inducing ligand, APRIL [117117] (1 species)
  7. 793613Species Mouse (Mus musculus) [TaxId:10090] [117118] (5 PDB entries)
    Uniprot Q9D777 105-251
    Uniprot Q9D777 105-241
    Uniprot Q9D777 105-251 ! Uniprot Q9D777 105-241
  8. 793615Domain d1xu1b_: 1xu1 B: [116034]
    Other proteins in same PDB: d1xu1r_, d1xu1s_, d1xu1t_

Details for d1xu1b_

PDB Entry: 1xu1 (more details), 1.9 Å

PDB Description: The crystal structure of APRIL bound to TACI
PDB Compounds: (B:) Tumor necrosis factor ligand superfamily member 13

SCOP Domain Sequences for d1xu1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu1b_ b.22.1.1 (B:) A proliferation-inducing ligand, APRIL {Mouse (Mus musculus) [TaxId: 10090]}
khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
aklslsphgtflgfvkl

SCOP Domain Coordinates for d1xu1b_:

Click to download the PDB-style file with coordinates for d1xu1b_.
(The format of our PDB-style files is described here.)

Timeline for d1xu1b_: