SCOP 1.75: Domain d1xu1a_: 1xu1 A:

Lineage for d1xu1a_ (1xu1 A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (1 family)

5. Family b.22.1.1: TNF-like [49843] (14 proteins)

6. Protein A proliferation-inducing ligand, APRIL [117117] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117118] (5 PDB entries)
   Uniprot Q9D777 105-251
   Uniprot Q9D777 105-241
   Uniprot Q9D777 105-251 ! Uniprot Q9D777 105-241

8. Domain d1xu1a_: 1xu1 A: [116033]
   Other proteins in same PDB: d1xu1r_, d1xu1s_, d1xu1t_

Details for d1xu1a_

PDB Entry: 1xu1, 1.9 Å

PDB Description: The crystal structure of APRIL bound to TACI

PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 13

SCOP Domain Sequences for d1xu1a_:

Sequence; same for both SEQRES and ATOM records:

>d1xu1a_ b.22.1.1 (A:) A proliferation-inducing ligand, APRIL {Mouse (Mus musculus) [TaxId: 10090]}
khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
aklslsphgtflgfvkl

Timeline for d1xu1a_:

• d1xu1a_ first appeared in SCOP 1.71
  
• d1xu1a_ appears in SCOP 1.73
  
• d1xu1a_ appears in SCOPe 2.01
  
• d1xu1a_ appears in the current release, SCOPe 2.08