Lineage for d1xu0a_ (1xu0 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597694Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 597695Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 597696Family d.6.1.1: Prion-like [54099] (2 proteins)
  6. 597697Protein Prion protein domain [54100] (12 species)
  7. 597698Species African clawed frog (Xenopus laevis) [TaxId:8355] [117768] (1 PDB entry)
  8. 597699Domain d1xu0a_: 1xu0 A: [116032]

Details for d1xu0a_

PDB Entry: 1xu0 (more details)

PDB Description: solution structure of xenopus leavis prion protein

SCOP Domain Sequences for d1xu0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu0a_ d.6.1.1 (A:) Prion protein domain {African clawed frog (Xenopus laevis)}
iggymlgnavgrmsyqfnnpmesryyndyynqmpnrvyrpmyrgeeyvsedrfvrdcynm
svteyiikpaegknnselnqldttvksqiiremciteyrrgs

SCOP Domain Coordinates for d1xu0a_:

Click to download the PDB-style file with coordinates for d1xu0a_.
(The format of our PDB-style files is described here.)

Timeline for d1xu0a_: