Lineage for d1xtpa_ (1xtp A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 588626Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 588627Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families) (S)
  5. 589110Family c.66.1.42: AD-003 protein-like [117685] (1 protein)
    Pfam 05891; DUF858
  6. 589111Protein Hypothetical protein Lmaj004091aaa (LmjF30.0810) [117686] (1 species)
  7. 589112Species Leishmania major [TaxId:5664] [117687] (1 PDB entry)
  8. 589113Domain d1xtpa_: 1xtp A: [116031]
    Structural genomics target
    complexed with sai

Details for d1xtpa_

PDB Entry: 1xtp (more details), 1.94 Å

PDB Description: Structural Analysis of Leishmania major LMAJ004091AAA, a SAM-dependent methyltransferase of the DUF858/Pfam05891 family

SCOP Domain Sequences for d1xtpa_:

Sequence, based on SEQRES records: (download)

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major}
gpgsmpskeassrnlpisgrdtngktyrstdemwkaeltgdlydpekgwygkaleywrtv
patvsgvlggmdhvhdvdiegsrnfiaslpghgtsraldcgagigritknlltklyattd
llepvkhmleeakrelagmpvgkfilasmetatlppntydliviqwtaiyltdadfvkff
khcqqaltpngyiffkencstgdrflvdkedssltrsdihykrlfnesgvrvvkeafqee
wptdlfplkmyalk

Sequence, based on observed residues (ATOM records): (download)

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major}
gpgsmprnlpisgrdtngktyrstdemwkaeltgdlydpekgwygkaleywrtvpatvsg
vlggmdhvhdvdiegsrnfiaslpghgtsraldcgagigritknlltklyattdllepvk
hmleeakrelagmpvgkfilasmetatlppntydliviqwtaiyltdadfvkffkhcqqa
ltpngyiffkencsdrflvdkedssltrsdihykrlfnesgvrvvkeafqeewptdlfpl
kmyalk

SCOP Domain Coordinates for d1xtpa_:

Click to download the PDB-style file with coordinates for d1xtpa_.
(The format of our PDB-style files is described here.)

Timeline for d1xtpa_: