Lineage for d1xtpa1 (1xtp A:5-254)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130297Family c.66.1.42: AD-003 protein-like [117685] (3 protein domains)
    Pfam PF05891; DUF858
  6. 2130301Protein Hypothetical protein Lmaj004091aaa (LmjF30.0810) [117686] (1 species)
  7. 2130302Species Leishmania major [TaxId:5664] [117687] (1 PDB entry)
    Uniprot Q4Q7M2
  8. 2130303Domain d1xtpa1: 1xtp A:5-254 [116031]
    Other proteins in same PDB: d1xtpa2
    Structural genomics target
    complexed with sai

Details for d1xtpa1

PDB Entry: 1xtp (more details), 1.94 Å

PDB Description: Structural Analysis of Leishmania major LMAJ004091AAA, a SAM-dependent methyltransferase of the DUF858/Pfam05891 family
PDB Compounds: (A:) lmaj004091aaa

SCOPe Domain Sequences for d1xtpa1:

Sequence, based on SEQRES records: (download)

>d1xtpa1 c.66.1.42 (A:5-254) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}
mpskeassrnlpisgrdtngktyrstdemwkaeltgdlydpekgwygkaleywrtvpatv
sgvlggmdhvhdvdiegsrnfiaslpghgtsraldcgagigritknlltklyattdllep
vkhmleeakrelagmpvgkfilasmetatlppntydliviqwtaiyltdadfvkffkhcq
qaltpngyiffkencstgdrflvdkedssltrsdihykrlfnesgvrvvkeafqeewptd
lfplkmyalk

Sequence, based on observed residues (ATOM records): (download)

>d1xtpa1 c.66.1.42 (A:5-254) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}
mprnlpisgrdtngktyrstdemwkaeltgdlydpekgwygkaleywrtvpatvsgvlgg
mdhvhdvdiegsrnfiaslpghgtsraldcgagigritknlltklyattdllepvkhmle
eakrelagmpvgkfilasmetatlppntydliviqwtaiyltdadfvkffkhcqqaltpn
gyiffkencsdrflvdkedssltrsdihykrlfnesgvrvvkeafqeewptdlfplkmya
lk

SCOPe Domain Coordinates for d1xtpa1:

Click to download the PDB-style file with coordinates for d1xtpa1.
(The format of our PDB-style files is described here.)

Timeline for d1xtpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xtpa2