Lineage for d1xtoa_ (1xto A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224695Family d.157.1.6: Coenzyme PQQ synthesis protein B, PqqB [118146] (2 proteins)
  6. 1224696Protein Coenzyme PQQ synthesis protein B, PqqB [118147] (1 species)
  7. 1224697Species Pseudomonas putida [TaxId:303] [118148] (1 PDB entry)
    Uniprot Q88QV5
  8. 1224698Domain d1xtoa_: 1xto A: [116030]
    Structural genomics target
    complexed with zn

Details for d1xtoa_

PDB Entry: 1xto (more details), 2.8 Å

PDB Description: crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida, northeast structural genomics target ppr6
PDB Compounds: (A:) Coenzyme PQQ synthesis protein B

SCOPe Domain Sequences for d1xtoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]}
myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdi
raqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdltt
gfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgdn
lglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtgr
emghlaqngpggmlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms
iell

SCOPe Domain Coordinates for d1xtoa_:

Click to download the PDB-style file with coordinates for d1xtoa_.
(The format of our PDB-style files is described here.)

Timeline for d1xtoa_: