Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (11 families) |
Family d.157.1.6: Coenzyme PQQ synthesis protein B, PqqB [118146] (1 protein) |
Protein Coenzyme PQQ synthesis protein B, PqqB [118147] (1 species) |
Species Pseudomonas putida [TaxId:303] [118148] (1 PDB entry) |
Domain d1xtoa_: 1xto A: [116030] Structural genomics target complexed with zn |
PDB Entry: 1xto (more details), 2.8 Å
SCOP Domain Sequences for d1xtoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdi raqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdltt gfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgdn lglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtgr emghlaqngpggmlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms iell
Timeline for d1xtoa_: