Lineage for d1xtnb_ (1xtn B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005656Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 3005657Superfamily d.189.1: PX domain [64268] (2 families) (S)
  5. 3005658Family d.189.1.1: PX domain [64269] (6 proteins)
    Pfam PF00787
  6. 3005669Protein Serine/threonine-protein kinase Sgk3, Cisk [117932] (1 species)
  7. 3005670Species Mouse (Mus musculus) [TaxId:10090] [117933] (2 PDB entries)
    Uniprot Q9ERE3 10-125 ! Uniprot Q9ERE3 11-121
  8. 3005673Domain d1xtnb_: 1xtn B: [116029]
    complexed with so4

Details for d1xtnb_

PDB Entry: 1xtn (more details), 2.2 Å

PDB Description: crystal structure of cisk-px domain with sulfates
PDB Compounds: (B:) Serine/threonine-protein kinase Sgk3

SCOPe Domain Sequences for d1xtnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtnb_ d.189.1.1 (B:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]}
cpsvsipssdehrekkkrftvykvlvsvgrsewfvfrryaefdklynslkkqfpamalki
pakrifgdnfdpdfikqrraglnefiqnlvrypelynhpdvraflqmdsprhq

SCOPe Domain Coordinates for d1xtnb_:

Click to download the PDB-style file with coordinates for d1xtnb_.
(The format of our PDB-style files is described here.)

Timeline for d1xtnb_: