Lineage for d1xtja2 (1xtj A:255-423)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870870Protein Spliceosome RNA helicase BAT1 (UAP56) [110562] (1 species)
  7. 2870871Species Human (Homo sapiens) [TaxId:9606] [110563] (5 PDB entries)
    Uniprot Q13838 45-428
  8. 2870878Domain d1xtja2: 1xtj A:255-423 [116025]
    complexed with acy, adp, mg

Details for d1xtja2

PDB Entry: 1xtj (more details), 2.7 Å

PDB Description: structure of human UAP56 in complex with ADP
PDB Compounds: (A:) Probable ATP-dependent RNA helicase p47

SCOPe Domain Sequences for d1xtja2:

Sequence, based on SEQRES records: (download)

>d1xtja2 c.37.1.19 (A:255-423) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}
tkltlhglqqyyvklkdneknrklfdlldvlefnqvvifvksvqrcialaqllveqnfpa
iaihrgmpqeerlsryqqfkdfqrrilvatnlfgrgmdiervniafnydmpedsdtylhr
varagrfgtkglaitfvsdendakilndvqdrfevniselpdeidissy

Sequence, based on observed residues (ATOM records): (download)

>d1xtja2 c.37.1.19 (A:255-423) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}
tkltlhglqqyyvklkdneknrklfdlldvlefnqvvifvksvqrcialaqllveqnfpa
iaihrgmpqeerlsryqqfkdfqrrilvatnldiervniafnydmpedsdtylhrvarag
rfgtkglaitfvsdendakilndvqdrfevniselpdeidissy

SCOPe Domain Coordinates for d1xtja2:

Click to download the PDB-style file with coordinates for d1xtja2.
(The format of our PDB-style files is described here.)

Timeline for d1xtja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xtja1