Lineage for d1xtja1 (1xtj A:46-254)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 583265Family c.37.1.19: Tandem AAA-ATPase domain [81268] (13 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 583349Protein Spliceosome RNA helicase BAT1 (UAP56) [110562] (1 species)
  7. 583350Species Human (Homo sapiens) [TaxId:9606] [110563] (5 PDB entries)
  8. 583356Domain d1xtja1: 1xtj A:46-254 [116024]

Details for d1xtja1

PDB Entry: 1xtj (more details), 2.7 Å

PDB Description: structure of human UAP56 in complex with ADP

SCOP Domain Sequences for d1xtja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtja1 c.37.1.19 (A:46-254) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens)}
gfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktavfvlatlq
qlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkdeevlkknc
phivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdvqeifrmtphekqvm
mfsatlskeirpvcrkfmqdpmeifvdde

SCOP Domain Coordinates for d1xtja1:

Click to download the PDB-style file with coordinates for d1xtja1.
(The format of our PDB-style files is described here.)

Timeline for d1xtja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xtja2