SCOPe 2.03: Domain d1xtia2: 1xti A:255-423

Lineage for d1xtia2 (1xti A:255-423)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Spliceosome RNA helicase BAT1 (UAP56) [110562] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110563] (5 PDB entries)
   Uniprot Q13838 45-428

8. Domain d1xtia2: 1xti A:255-423 [116023]
   complexed with ipa

Details for d1xtia2

PDB Entry: 1xti, 1.95 Å

PDB Description: Structure of Wildtype human UAP56

PDB Compounds: (A:) Probable ATP-dependent RNA helicase p47

SCOPe Domain Sequences for d1xtia2:

Sequence; same for both SEQRES and ATOM records:

>d1xtia2 c.37.1.19 (A:255-423) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}
tkltlhglqqyyvklkdneknrklfdlldvlefnqvvifvksvqrcialaqllveqnfpa
iaihrgmpqeerlsryqqfkdfqrrilvatnlfgrgmdiervniafnydmpedsdtylhr
varagrfgtkglaitfvsdendakilndvqdrfevniselpdeidissy

Timeline for d1xtia2:

• d1xtia2 first appeared in SCOP 1.71
  
• d1xtia2 appears in SCOPe 2.02
  
• d1xtia2 appears in SCOPe 2.04
  
• d1xtia2 appears in the current release, SCOPe 2.08