| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Spliceosome RNA helicase BAT1 (UAP56) [110562] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [110563] (5 PDB entries) Uniprot Q13838 45-428 |
| Domain d1xtia2: 1xti A:255-423 [116023] complexed with ipa |
PDB Entry: 1xti (more details), 1.95 Å
SCOPe Domain Sequences for d1xtia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtia2 c.37.1.19 (A:255-423) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}
tkltlhglqqyyvklkdneknrklfdlldvlefnqvvifvksvqrcialaqllveqnfpa
iaihrgmpqeerlsryqqfkdfqrrilvatnlfgrgmdiervniafnydmpedsdtylhr
varagrfgtkglaitfvsdendakilndvqdrfevniselpdeidissy
Timeline for d1xtia2: