Lineage for d1xtfa_ (1xtf A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607530Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 607531Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 607673Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (1 protein)
  6. 607674Protein Botulinum neurotoxin [55513] (3 species)
  7. 607675Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (4 PDB entries)
  8. 607679Domain d1xtfa_: 1xtf A: [116018]

Details for d1xtfa_

PDB Entry: 1xtf (more details), 2.2 Å

PDB Description: neurotoxin bont/a e224q y366f mutant

SCOP Domain Sequences for d1xtfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtfa_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype A}
pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahqlihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktflnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftp
ghhhhhh

SCOP Domain Coordinates for d1xtfa_:

Click to download the PDB-style file with coordinates for d1xtfa_.
(The format of our PDB-style files is described here.)

Timeline for d1xtfa_: