Lineage for d1xtfa1 (1xtf A:2-422)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529349Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2529350Protein Botulinum neurotoxin [55513] (4 species)
  7. 2529351Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (29 PDB entries)
    Uniprot P10845 1-419
  8. 2529369Domain d1xtfa1: 1xtf A:2-422 [116018]
    Other proteins in same PDB: d1xtfa2, d1xtfb2
    complexed with zn; mutant

Details for d1xtfa1

PDB Entry: 1xtf (more details), 2.2 Å

PDB Description: neurotoxin bont/a e224q y366f mutant
PDB Compounds: (A:) Neurotoxin BoNT/A

SCOPe Domain Sequences for d1xtfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtfa1 d.92.1.7 (A:2-422) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahqlihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktflnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftp
g

SCOPe Domain Coordinates for d1xtfa1:

Click to download the PDB-style file with coordinates for d1xtfa1.
(The format of our PDB-style files is described here.)

Timeline for d1xtfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xtfa2