Lineage for d1xtda2 (1xtd A:95-172)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
barrel, closed; n=5, S=8
Protein C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) [50296] (5 species) 
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [117196] (1 PDB entry)
Uniprot Q9N9V6 97% sequence identity
Domain d1xtda2: 1xtd A:95-172 [116016]
Other proteins in same PDB: d1xtda1
has additional insertions and/or extensions that are not grouped together
Details for d1xtda2
PDB Entry: 1xtd (more details), 2.7 Å
PDB Description: Structural Analysis of Leishmania mexicana eukaryotic initiation factor 5a
PDB Compounds: (A:) eukaryotic initiation factor 5aSCOPe Domain Sequences for d1xtda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtda2 b.40.4.5 (A:95-172) C-terminal domain of eukaryotic initiation translation factor 5a (eIF5a) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
vktftysvldiqpnedpslpshlslmddegesredldmppdaalatqikeqfdsgkevlv
vvvsamgteqvlqtknaa
SCOPe Domain Coordinates for d1xtda2:
Click to download the PDB-style file with coordinates for d1xtda2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xtda2:
- d1xtda2 first appeared in SCOP 1.71
- d1xtda2 appears in SCOPe 2.07
View in 3D
