Lineage for d1xt9b_ (1xt9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931416Protein Nedd8 [54244] (1 species)
  7. 2931417Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
    Uniprot Q15843
  8. 2931425Domain d1xt9b_: 1xt9 B: [116014]
    Other proteins in same PDB: d1xt9a_

Details for d1xt9b_

PDB Entry: 1xt9 (more details), 2.2 Å

PDB Description: Crystal Structure of Den1 in complex with Nedd8
PDB Compounds: (B:) Neddylin

SCOPe Domain Sequences for d1xt9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xt9b_ d.15.1.1 (B:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOPe Domain Coordinates for d1xt9b_:

Click to download the PDB-style file with coordinates for d1xt9b_.
(The format of our PDB-style files is described here.)

Timeline for d1xt9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xt9a_