SCOP 1.71: Domain d1xt9a_: 1xt9 A:

Lineage for d1xt9a_ (1xt9 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (12 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (4 proteins)
   Pfam 02902; Ulp1 protease family

6. Protein Sentrin-specific protease 8, SENP8 [117760] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117761] (1 PDB entry)

8. Domain d1xt9a_: 1xt9 A: [116013]
   Other proteins in same PDB: d1xt9b_

Details for d1xt9a_

PDB Entry: 1xt9, 2.2 Å

PDB Description: Crystal Structure of Den1 in complex with Nedd8

SCOP Domain Sequences for d1xt9a_:

Sequence, based on SEQRES records:

>d1xt9a_ d.3.1.7 (A:) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens)}
dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdcsdhvsfispevtqf
ikctsnpaeiamflepldlpnkrvvflaindnsnqaaggthwsllvylqdknsffhydsh
srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq
qtesllqlltpayitkkrgewkdlittlak

Sequence, based on observed residues (ATOM records):

>d1xt9a_ d.3.1.7 (A:) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens)}
dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdcsdhvsfispevtqf
ikctsneiamflepldlpnkrvvflaindnsnqaaggthwsllvylqdknsffhydshsr
snsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrqqt
esllqlltpayitkkrgewkdlittlak

Timeline for d1xt9a_:

• d1xt9a_ is new in SCOP 1.71
  
• d1xt9a_ appears in SCOP 1.73
  
• d1xt9a_ appears in the current release, SCOPe 2.08