Lineage for d1xt6a_ (1xt6 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838448Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1838449Protein Flavodoxin [52220] (10 species)
  7. 1838485Species Desulfovibrio vulgaris [TaxId:881] [52222] (25 PDB entries)
    Uniprot P00323
  8. 1838499Domain d1xt6a_: 1xt6 A: [116012]
    complexed with fmn; mutant

Details for d1xt6a_

PDB Entry: 1xt6 (more details), 1.8 Å

PDB Description: s35c flavodoxin mutant in the semiquinone state
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d1xt6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xt6a_ c.23.5.1 (A:) Flavodoxin {Desulfovibrio vulgaris [TaxId: 881]}
akalivygsttgnteytaetiareladagyevdcrdaasveagglfegfdlvllgcstwg
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai

SCOPe Domain Coordinates for d1xt6a_:

Click to download the PDB-style file with coordinates for d1xt6a_.
(The format of our PDB-style files is described here.)

Timeline for d1xt6a_: