SCOPe 2.07: Domain d1xt0b1: 1xt0 B:2-201

Lineage for d1xt0b1 (1xt0 B:2-201)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (2 families)

5. Family a.118.3.1: Sec7 domain [48426] (6 proteins)
   Pfam PF01369

6. Protein RalF, N-terminal domain [117005] (1 species)

7. Species Legionella pneumophila [TaxId:446] [117006] (2 PDB entries)
   Uniprot Q8RT31 2-353

8. Domain d1xt0b1: 1xt0 B:2-201 [116009]
   Other proteins in same PDB: d1xt0b2

Details for d1xt0b1

PDB Entry: 1xt0, 2.16 Å

PDB Description: The Structure of N-terminal Sec7 domain of RalF

PDB Compounds: (B:) guanine nucleotide exchange protein

SCOPe Domain Sequences for d1xt0b1:

Sequence; same for both SEQRES and ATOM records:

>d1xt0b1 a.118.3.1 (B:2-201) RalF, N-terminal domain {Legionella pneumophila [TaxId: 446]}
hpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleavgdy
lsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgayfqq
npdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdakfle
elyseikakpfelnfvktsp

Timeline for d1xt0b1:

• d1xt0b1 first appeared in SCOP 1.71, called d1xt0b_
  
• d1xt0b1 appears in SCOPe 2.06
  
• d1xt0b1 appears in the current release, SCOPe 2.08