SCOPe 2.05: Domain d1xt0b_: 1xt0 B:

Lineage for d1xt0b_ (1xt0 B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (2 families)

5. Family a.118.3.1: Sec7 domain [48426] (6 proteins)
   Pfam PF01369

6. Protein RalF, N-terminal domain [117005] (1 species)

7. Species Legionella pneumophila [TaxId:446] [117006] (2 PDB entries)
   Uniprot Q8RT31 2-353

8. Domain d1xt0b_: 1xt0 B: [116009]

Details for d1xt0b_

PDB Entry: 1xt0, 2.16 Å

PDB Description: The Structure of N-terminal Sec7 domain of RalF

PDB Compounds: (B:) guanine nucleotide exchange protein

SCOPe Domain Sequences for d1xt0b_:

Sequence; same for both SEQRES and ATOM records:

>d1xt0b_ a.118.3.1 (B:) RalF, N-terminal domain {Legionella pneumophila [TaxId: 446]}
gashpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleav
gdylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgay
fqqnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdak
fleelyseikakpfelnfvktsp

Timeline for d1xt0b_:

• d1xt0b_ first appeared in SCOP 1.71
  
• d1xt0b_ appears in SCOPe 2.04
  
• d1xt0b_ is called d1xt0b1 in SCOPe 2.06
  
• d1xt0b_ appears in the current release, SCOPe 2.08, called d1xt0b1