Lineage for d1xt0b_ (1xt0 B:)
- Root: SCOP 1.73
Class a: All alpha proteins [46456] (258 folds) 
Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.3: Sec7 domain [48425] (1 family) 
Family a.118.3.1: Sec7 domain [48426] (5 proteins)
Pfam PF01369
Protein RalF, N-terminal domain [117005] (1 species) Species Legionella pneumophila [TaxId:446] [117006] (2 PDB entries) 
Domain d1xt0b_: 1xt0 B: [116009]
Details for d1xt0b_
PDB Entry: 1xt0 (more details), 2.16 Å
PDB Description: The Structure of N-terminal Sec7 domain of RalF
PDB Compounds: (B:) guanine nucleotide exchange proteinSCOP Domain Sequences for d1xt0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xt0b_ a.118.3.1 (B:) RalF, N-terminal domain {Legionella pneumophila [TaxId: 446]}
gashpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleav
gdylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgay
fqqnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdak
fleelyseikakpfelnfvktsp
SCOP Domain Coordinates for d1xt0b_:
Click to download the PDB-style file with coordinates for d1xt0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xt0b_:
- d1xt0b_ first appeared in SCOP 1.71
- d1xt0b_ appears in SCOP 1.75
- d1xt0b_ appears in the current release, SCOPe 2.08, called d1xt0b1
View in 3D