Lineage for d1xszb2 (1xsz B:198-353)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2215532Superfamily d.129.9: RalF, C-terminal domain [118104] (1 family) (S)
    contains a single copy of this fold decorated with additional structures
  5. 2215533Family d.129.9.1: RalF, C-terminal domain [118105] (2 proteins)
  6. 2215534Protein RalF, C-terminal domain [118106] (1 species)
  7. 2215535Species Legionella pneumophila [TaxId:446] [118107] (1 PDB entry)
    Uniprot Q8RT31 2-353
  8. 2215537Domain d1xszb2: 1xsz B:198-353 [116008]
    Other proteins in same PDB: d1xsza1, d1xsza3, d1xsza4, d1xszb1, d1xszb3, d1xszb4

Details for d1xszb2

PDB Entry: 1xsz (more details), 1.41 Å

PDB Description: The structure of RalF
PDB Compounds: (B:) guanine nucleotide exchange protein

SCOPe Domain Sequences for d1xszb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xszb2 d.129.9.1 (B:198-353) RalF, C-terminal domain {Legionella pneumophila [TaxId: 446]}
ktspgyeltsttlnkdstfkkldsflhstdvnintvfpgigdnvkttvdqpkswlsfftg
ykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqpgqtkesidlaakaaadfss
pvknfkatydyevgdlikaydnqkklitiernlalk

SCOPe Domain Coordinates for d1xszb2:

Click to download the PDB-style file with coordinates for d1xszb2.
(The format of our PDB-style files is described here.)

Timeline for d1xszb2: